frackfreenorthwest.org

frackfreemayfieldandfiveashes.org

Frack free Mayfield and Five Ashes - Home

Frack Free Sussex shop. Frack free Mayfield and Five Ashes. We are a group of residents concerned about protecting our beautiful Wealden village from the threat of onshore gas and oil exploration. We met through Transition Mayfield. And share a common interest in the environment. We have set up a Residents' Association which you can join if you live in the Parish which will keep you up to date with news and developments. If you would like to join or if you would like any further information contact at.

frackfreenation.org

frackfreenation.org

Welcome to: frackfreenation.org. This Web page is parked for FREE, courtesy of GoDaddy.com. Is this your domain? Let's turn it into a website! Would you like to buy this. THE domain at THE price. Visit GoDaddy.com for the best values on. Restrictions apply. See website for details.

frackfreenc.org

Frack Free NC - The grassroots movement to keep natural gas development out of North Carolina

Resolutions & Ordinances. Mining and Energy Commission. Factsheets & Reports. Sign the Frack Free NC Petition. Working with Local Governments. Take Action on Fracking in NC! Yard signs of this image against fracking and the Atlantic Coast Pipeline in NC are now available! Please call ahead to arrange a pickup from Clean Water for NC's Durham (919-401-9600) or Asheville (828-251-1291) office. About the Frack Free NC Alliance. To keep NC frack-free! The compressor station is expected to release toxic air p...

frackfreenetwork.org

FrackFreeNetwork.org

Global Network to BAN Fracking. Informations about the FRACK FREE Network. The Frack Free Network. Click to enter in AMERICA. Click to enter in EUROPA. Click to enter in AFRICA. Click to enter in ASIA. Global Network Against Fracking. This network has been created in czech republic the 7th March 2013 by representatives and members of antifracking groups from 13 countries. This network is open for each AntiFracking group, representative or organisation. Our "Fracking" definition is :.

frackfreenorthwest.org

Frack Free North West for the latest News and updates on Fracking

Frack Free North West (FFNW). Is part of an expanding national movement that opposes the development and extraction of shale gas worldwide. The damaging effects of hydraulic fracturing have been extensively highlighted by leading scientists. The anti-fracking movement is growing in strength. Hundreds of localised groups have developed across the UK over the last five years and communities have come together in solidarity to form their own anti-fracking groups. Facebook By Weblizar Powered By Weblizar.

frackfreenorthyorkshire.com

Frack Free North Yorkshire – Frack Free North Yorkshire is a community group opposed to hydraulic fracturing known as 'fracking' within Ryedale and North Yorkshire.

Frack Free North Yorkshire. Frack Free North Yorkshire is a community group opposed to hydraulic fracturing known as 'fracking' within Ryedale and North Yorkshire. Fracking Myths & Facts. Campaign resources and films. Third Energy KM8 Application. Sign our petition to NYCC. KM8 – Act Now! Frack Free North Yorkshire News. Please sign the People’s Declaration against fracking. By Frack Free North Yorkshire. Fracking Firm Third Energy exposed issuing false air pollution data. By Frack Free North Yorkshire.

frackfreenotts.org.uk

Frack Free Nottinghamshire

Speak to your councillor. Monitoring Planning Application: OBJECT. Speaker / Info Request. Object to the Misson monitoring planning application. August 4, 2015. IGas have submitted a planning application to install monitoring boreholes at Misson Springs in Bassetlaw. The reason for this is because the Infrastructure Act passed requires companies to carry out 12 months of monitoring before fracking can begin. Read more about the application and how you can object on our[.]. Speak up for the wildlife!

frackfreenz.org

Frack Free NZ Organisation

FRACK FREE AOTEAROA NZ. Te toto o te tangata he kai te oranga o te tangata he whenua. Food is the blood of the people but the welfare of the people lies in the land'. Welcome to the Frack-Free NZ. We aim to provide you with all the information you need you need to know about Hydraulic Fracturing (fracking) from the basic 'what is fracking' to peer reviewed studies. Parliamentary Commissioner for the Environment Report: Drilling for Oil and Gas in NZ. CLICK HERE TO DOWNLOAD. CLICK HERE TO DOWNLOAD.

frackfreeryedale.org

frackfreeryedale.org

Residents’ Brochure – fact or fiction? Are Halliburton coming to Ryedale? Rally for a Frack Free Ryedale – MALTON, SATURDAY 25th APRIL, 12.00. RDC Election Results 2015. Hollinrake Parliamentary Debate on Shale Gas. KM8 Water Monitoring Borehole Application – how to object. Ebberston Moor South re-injection well – Planning Meeting. KM8 Environment Agency consultation – response guidelines. Kirby Misperton NYCC Planning Application. EA Consultations – Ebberston and Pickering. How Can I Help? We are concer...

frackfreescotland.wordpress.com

Frack Free Scotland | for a coalbed methane and fracking free Scotland

For a coalbed methane and fracking free Scotland. Skip to primary content. Skip to secondary content. What’s happening in Scotland? Act now to stop CBM at Airth! If you do one thing before Christmas…. December 18, 2012. To demand that Parliament and Government start to address concerns about unconventional gas and fracking now! If you do two things before Christmas, email your MP too. Find out about more about the demo here. Autumn statement, fracking resumes and some great media coverage! The good news ...