Frack Free North Yorkshire is a community group opposed to hydraulic fracturing known as 'fracking' within Ryedale and North Yorkshire.
http://www.frackfreenorthyorkshire.com/
TODAY'S RATING
>1,000,000
Date Range
HIGHEST TRAFFIC ON
Saturday
LOAD TIME
1.1 seconds
16x16
32x32
Domains By Proxy, LLC
Registration Private
Domain●●●●●●xy.com
14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309
Sco●●●ale , Arizona, 85260
United States
View this contact
Domains By Proxy, LLC
Registration Private
Domain●●●●●●xy.com
14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309
Sco●●●ale , Arizona, 85260
United States
View this contact
Domains By Proxy, LLC
Registration Private
Domain●●●●●●xy.com
14747 N Norths●●●●●●●●●●●●●●e 111, PMB 309
Sco●●●ale , Arizona, 85260
United States
View this contact
BUY YOUR DOMAIN
10
YEARS
0
MONTHS
29
DAYS
WILD WEST DOMAINS, LLC
WHOIS : whois.wildwestdomains.com
REFERRED : http://www.wildwestdomains.com
PAGES IN
THIS WEBSITE
10
SSL
EXTERNAL LINKS
35
SITE IP
5.133.182.68
LOAD TIME
1.104 sec
SCORE
6.2
Frack Free North Yorkshire – Frack Free North Yorkshire is a community group opposed to hydraulic fracturing known as 'fracking' within Ryedale and North Yorkshire. | frackfreenorthyorkshire.com Reviews
https://frackfreenorthyorkshire.com
Frack Free North Yorkshire is a community group opposed to hydraulic fracturing known as 'fracking' within Ryedale and North Yorkshire.
frackfreenorthyorkshire.com
Latest events anouncement coming soon
http://frackfreenorthyorkshire.com/latest-events-anouncement-coming-soon
Frack Free North Yorkshire. Frack Free North Yorkshire is a community group opposed to hydraulic fracturing known as 'fracking' within Ryedale and North Yorkshire. Campaign resources and films. Fracking Myths & Facts. Third Energy KM8 Application. Sign our petition to NYCC. KM8 – Act Now! Latest events anouncement coming soon. By Frack Free North Yorkshire. To keep up to date with the latest events planned by Frack Free North Yorkshire please sign up to our regular news letters via the contact us page.
News
http://frackfreenorthyorkshire.com/category/news
Frack Free North Yorkshire. Frack Free North Yorkshire is a community group opposed to hydraulic fracturing known as 'fracking' within Ryedale and North Yorkshire. Campaign resources and films. Fracking Myths & Facts. Third Energy KM8 Application. Sign our petition to NYCC. KM8 – Act Now! Thousands attend the #DontFrackYorkshire rally in York. By Frack Free North Yorkshire. Yorkshire-wide March and Rally on the 30th July – all welcome! By Frack Free North Yorkshire. By Frack Free North Yorkshire. At Frid...
Events
http://frackfreenorthyorkshire.com/category/events
Frack Free North Yorkshire. Frack Free North Yorkshire is a community group opposed to hydraulic fracturing known as 'fracking' within Ryedale and North Yorkshire. Campaign resources and films. Fracking Myths & Facts. Third Energy KM8 Application. Sign our petition to NYCC. KM8 – Act Now! Yorkshire-wide March and Rally on the 30th July – all welcome! By Frack Free North Yorkshire. Yorkshire-wide March and Rally - all welcome! Benefit concert for Frackfree Ryedale – 22 April – Pickering. Feathers Hotel, H...
Latest news from around the county
http://frackfreenorthyorkshire.com/latest-news-from-around-the-county
Frack Free North Yorkshire. Frack Free North Yorkshire is a community group opposed to hydraulic fracturing known as 'fracking' within Ryedale and North Yorkshire. Campaign resources and films. Fracking Myths & Facts. Third Energy KM8 Application. Sign our petition to NYCC. KM8 – Act Now! Latest news from around the county. By Frack Free North Yorkshire. What’s happening in Ryedale? Details of the survey were supplied to North Yorkshire County Council on 30. May (Planning application NY/2014/0162/PDN.
What is fracking?
http://frackfreenorthyorkshire.com/what-is-fracking
Frack Free North Yorkshire. Frack Free North Yorkshire is a community group opposed to hydraulic fracturing known as 'fracking' within Ryedale and North Yorkshire. Campaign resources and films. Fracking Myths & Facts. Third Energy KM8 Application. Sign our petition to NYCC. KM8 – Act Now! Fracking is the process of blasting water, sand and a cocktail of chemicals deep underground in order to get out the gas or oil,. 1 It could frack the climate. In fact, analysts like the International Energy Agency.
TOTAL PAGES IN THIS WEBSITE
10
frackfreeharrogatedistrict.com
Home | Frack Free Harrogate District
http://frackfreeharrogatedistrict.com/index.php/about
Frack Free Harrogate District. Why say no to fracking? The application was approved, but the fight continues. To fracking: Sign the People's Declaration. Frack Free Harrogate District is a locally based group aiming to articulate public opposition to and concerns about Fracking. Find us on Facebook here. This area has not yet been subject to bids but is likely to be in the future as Harrogate sits on Bowland Shale. Why say no to fracking? Leave a Reply Cancel reply. Required fields are marked *. Proudly ...
frackfreeharrogatedistrict.com
A Visit to the Kirby Misperton Protection Camp | Frack Free Harrogate District
http://frackfreeharrogatedistrict.com/index.php/2017/01/09/a-visit-to-the-kirby-misperton-protection-camp
Frack Free Harrogate District. Why say no to fracking? The application was approved, but the fight continues. To fracking: Sign the People's Declaration. A Visit to the Kirby Misperton Protection Camp. January 9, 2017. January 9, 2017. I visited the Kirby Misperton Protection Camp today, with my partner Robbie. The camp was set up just before Christmas by peaceful anti-fracking activists and local residents. Hern ring-road of York the sun came out and I thought it was going to be a beautiful afternoon in...
frackfreeharrogatedistrict.com
admin | Frack Free Harrogate District
http://frackfreeharrogatedistrict.com/index.php/author/admin
Frack Free Harrogate District. Why say no to fracking? The application was approved, but the fight continues. To fracking: Sign the People's Declaration. Fracking Visit Gave a Different Picture. January 7, 2016. Fracking visit gave a different picture – see here. WE need to paint a picture for local people to show them that [fracking can be done without industrialising the countryside]. At the moment, we are losing the PR war. . Was his Pennsylvania visit just a sham part of his self-proclaimed PR war?
frackfreeharrogatedistrict.com
Tim Ellis | Frack Free Harrogate District
http://frackfreeharrogatedistrict.com/index.php/author/tim
Frack Free Harrogate District. Why say no to fracking? The application was approved, but the fight continues. To fracking: Sign the People's Declaration. A Visit to the Kirby Misperton Protection Camp. January 9, 2017. January 9, 2017. I visited the Kirby Misperton Protection Camp today, with my partner Robbie. The camp was set up just before Christmas by peaceful anti-fracking activists and local residents. Hern ring-road of York the sun came out and I thought it was going to be a beautiful afternoon in...
frackfreeharrogatedistrict.com
Fracking Debunked | Frack Free Harrogate District
http://frackfreeharrogatedistrict.com/index.php/fracking-debunking-the-arguments-for
Frack Free Harrogate District. Why say no to fracking? The application was approved, but the fight continues. To fracking: Sign the People's Declaration. Critics of Fracking are ignorant and use myths to play on public fears. The risks are worth taking and we have the best regulated industry. The risks are being deliberately understated. The lights will go out if we don’t use shale. Why don’t we have incentives for solar pv panels and triple glazing? Renewables are too uneven to meet our energy needs.
frackfreeharrogatedistrict.com
Why say no to fracking? | Frack Free Harrogate District
http://frackfreeharrogatedistrict.com/index.php/why-say-no-to-fracking
Frack Free Harrogate District. Why say no to fracking? The application was approved, but the fight continues. To fracking: Sign the People's Declaration. Why say no to fracking? With unresolved and probably disastrous flaws short, medium and long term affecting water, air and environmental quality. Ref 1 and 2). The Intergovernmental Panel on Climate Change (IPCC) Nov 2014 report. Fracking takes us in wrong direction. Shale oil and gas. Not fit for purpose. Have banned fracking but. Evidence from the USA...
frackfreeharrogatedistrict.com
What we must do next. | Frack Free Harrogate District
http://frackfreeharrogatedistrict.com/index.php/2016/06/08/what-we-must-do-next
Frack Free Harrogate District. Why say no to fracking? The application was approved, but the fight continues. To fracking: Sign the People's Declaration. What we must do next. June 8, 2016. January 4, 2017. These are just a few ways in which you can help fight against fracking in the UK. 1 Switch your energy to renewables. Both supply renewable electricity and gas. If you haven’t researched renewable energy recently the good news is that it now costs exactly the same as non-renewable energy. Watch out fo...
frackfreeharrogatedistrict.com
NYCC approves fracking in Ryedale. | Frack Free Harrogate District
http://frackfreeharrogatedistrict.com/index.php/2016/05/25/nycc-approves-fracking-in-ryedale
Frack Free Harrogate District. Why say no to fracking? The application was approved, but the fight continues. To fracking: Sign the People's Declaration. NYCC approves fracking in Ryedale. May 25, 2016. September 29, 2016. On Monday 23rd May 2016, North Yorkshire County Coun. We are naturally very disappointed by this decision but everybody in the group is determined to fight on against the KM8 fracking operation and to oppose any further att. Empts to frack in Yorkshire or anywhere in the UK.
frackfreeharrogatedistrict.com
Fracking Visit Gave a Different Picture | Frack Free Harrogate District
http://frackfreeharrogatedistrict.com/index.php/2016/01/07/fracking-visit-gave-a-different-picture
Frack Free Harrogate District. Why say no to fracking? The application was approved, but the fight continues. To fracking: Sign the People's Declaration. Fracking Visit Gave a Different Picture. January 7, 2016. Fracking visit gave a different picture – see here. WE need to paint a picture for local people to show them that [fracking can be done without industrialising the countryside]. At the moment, we are losing the PR war. . Was his Pennsylvania visit just a sham part of his self-proclaimed PR war?
TOTAL LINKS TO THIS WEBSITE
35
frackfreemayfieldandfiveashes.org
Frack free Mayfield and Five Ashes - Home
Frack Free Sussex shop. Frack free Mayfield and Five Ashes. We are a group of residents concerned about protecting our beautiful Wealden village from the threat of onshore gas and oil exploration. We met through Transition Mayfield. And share a common interest in the environment. We have set up a Residents' Association which you can join if you live in the Parish which will keep you up to date with news and developments. If you would like to join or if you would like any further information contact at.
frackfreenation.org
Welcome to: frackfreenation.org. This Web page is parked for FREE, courtesy of GoDaddy.com. Is this your domain? Let's turn it into a website! Would you like to buy this. THE domain at THE price. Visit GoDaddy.com for the best values on. Restrictions apply. See website for details.
Frack Free NC - The grassroots movement to keep natural gas development out of North Carolina
Resolutions & Ordinances. Mining and Energy Commission. Factsheets & Reports. Sign the Frack Free NC Petition. Working with Local Governments. Take Action on Fracking in NC! Yard signs of this image against fracking and the Atlantic Coast Pipeline in NC are now available! Please call ahead to arrange a pickup from Clean Water for NC's Durham (919-401-9600) or Asheville (828-251-1291) office. About the Frack Free NC Alliance. To keep NC frack-free! The compressor station is expected to release toxic air p...
FrackFreeNetwork.org
Global Network to BAN Fracking. Informations about the FRACK FREE Network. The Frack Free Network. Click to enter in AMERICA. Click to enter in EUROPA. Click to enter in AFRICA. Click to enter in ASIA. Global Network Against Fracking. This network has been created in czech republic the 7th March 2013 by representatives and members of antifracking groups from 13 countries. This network is open for each AntiFracking group, representative or organisation. Our "Fracking" definition is :.
Frack Free North West for the latest News and updates on Fracking
Frack Free North West (FFNW). Is part of an expanding national movement that opposes the development and extraction of shale gas worldwide. The damaging effects of hydraulic fracturing have been extensively highlighted by leading scientists. The anti-fracking movement is growing in strength. Hundreds of localised groups have developed across the UK over the last five years and communities have come together in solidarity to form their own anti-fracking groups. Facebook By Weblizar Powered By Weblizar.
Frack Free North Yorkshire – Frack Free North Yorkshire is a community group opposed to hydraulic fracturing known as 'fracking' within Ryedale and North Yorkshire.
Frack Free North Yorkshire. Frack Free North Yorkshire is a community group opposed to hydraulic fracturing known as 'fracking' within Ryedale and North Yorkshire. Fracking Myths & Facts. Campaign resources and films. Third Energy KM8 Application. Sign our petition to NYCC. KM8 – Act Now! Frack Free North Yorkshire News. Please sign the People’s Declaration against fracking. By Frack Free North Yorkshire. Fracking Firm Third Energy exposed issuing false air pollution data. By Frack Free North Yorkshire.
Frack Free Nottinghamshire
Speak to your councillor. Monitoring Planning Application: OBJECT. Speaker / Info Request. Object to the Misson monitoring planning application. August 4, 2015. IGas have submitted a planning application to install monitoring boreholes at Misson Springs in Bassetlaw. The reason for this is because the Infrastructure Act passed requires companies to carry out 12 months of monitoring before fracking can begin. Read more about the application and how you can object on our[.]. Speak up for the wildlife!
Frack Free NZ Organisation
FRACK FREE AOTEAROA NZ. Te toto o te tangata he kai te oranga o te tangata he whenua. Food is the blood of the people but the welfare of the people lies in the land'. Welcome to the Frack-Free NZ. We aim to provide you with all the information you need you need to know about Hydraulic Fracturing (fracking) from the basic 'what is fracking' to peer reviewed studies. Parliamentary Commissioner for the Environment Report: Drilling for Oil and Gas in NZ. CLICK HERE TO DOWNLOAD. CLICK HERE TO DOWNLOAD.
frackfreeryedale.org
Residents’ Brochure – fact or fiction? Are Halliburton coming to Ryedale? Rally for a Frack Free Ryedale – MALTON, SATURDAY 25th APRIL, 12.00. RDC Election Results 2015. Hollinrake Parliamentary Debate on Shale Gas. KM8 Water Monitoring Borehole Application – how to object. Ebberston Moor South re-injection well – Planning Meeting. KM8 Environment Agency consultation – response guidelines. Kirby Misperton NYCC Planning Application. EA Consultations – Ebberston and Pickering. How Can I Help? We are concer...
frackfreescotland.wordpress.com
Frack Free Scotland | for a coalbed methane and fracking free Scotland
For a coalbed methane and fracking free Scotland. Skip to primary content. Skip to secondary content. What’s happening in Scotland? Act now to stop CBM at Airth! If you do one thing before Christmas…. December 18, 2012. To demand that Parliament and Government start to address concerns about unconventional gas and fracking now! If you do two things before Christmas, email your MP too. Find out about more about the demo here. Autumn statement, fracking resumes and some great media coverage! The good news ...
frackfreescunthorpe.wordpress.com
Frack Free Scunthorpe | Fighting to keep the Scunthorpe area frack free.
Fighting to keep the Scunthorpe area frack free. We are a group of people in the Scunthorpe area campaigning against fracking (hydraulic fracturing) and unconventional gas in Scunthorpe and the surrounding area. We work with local people and other anti fracking and environmental groups locally and nationally. Look out for details of our first public meeting on here soon. Freeman john of the family hall. November 30, 2015 at 1:51 pm. Liked by 1 person. Leave a Reply Cancel reply. Enter your comment here.
SOCIAL ENGAGEMENT